DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG3604 and C34F6.1

DIOPT Version :9

Sequence 1:	NP_001285595.1	Gene:	CG3604 / 33593	FlyBaseID:	FBgn0031562	Length:	132	Species:	Drosophila melanogaster
Sequence 2:	NP_509868.1	Gene:	C34F6.1 / 181306	WormBaseID:	WBGene00007938	Length:	1043	Species:	Caenorhabditis elegans

Alignment Length:	67	Identity:	24/67 - (35%)
Similarity:	35/67 - (52%)	Gaps:	7/67 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly    46 ASELTVPEDCHQP-------KETGRCFALFYRYAYNVDTQSCEEFVYGGCAGNKNNFESKEQCEQ 103
            :||..|...|..|       :::|.|.....||.|:.:|.:|.|:.||||.|..|||.|.::|.:
Worm   967 SSEFNVSICCQDPMDFCLSARDSGPCNNFEKRYGYDANTDTCVEYQYGGCEGTLNNFHSLQRCTE 1031

  Fly   104 AC 105
            .|
Worm  1032 IC 1033

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG3604	NP_001285595.1	KU	53..106	CDD:238057	21/60 (35%)
C34F6.1	NP_509868.1	Lustrin_cystein	186..231	CDD:291299
		Kunitz_BPTI	238..289	CDD:278443
		Lustrin_cystein	301..343	CDD:291299
		Kunitz_BPTI	351..403	CDD:278443
		Kunitz_BPTI	456..512	CDD:278443
		KU	564..617	CDD:238057
		Lustrin_cystein	623..663	CDD:291299
		KU	667..720	CDD:238057
		Lustrin_cystein	726..767	CDD:291299
		Kunitz_BPTI	772..824	CDD:278443
		Lustrin_cystein	829..873	CDD:291299
		KU	878..931	CDD:238057
		Lustrin_cystein	937..977	CDD:291299	3/9 (33%)
		Kunitz_BPTI	982..1033	CDD:278443	18/50 (36%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4295
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810