powered by:
Protein Alignment CG3604 and C34F6.1
DIOPT Version :9
Sequence 1: | NP_001285595.1 |
Gene: | CG3604 / 33593 |
FlyBaseID: | FBgn0031562 |
Length: | 132 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_509868.1 |
Gene: | C34F6.1 / 181306 |
WormBaseID: | WBGene00007938 |
Length: | 1043 |
Species: | Caenorhabditis elegans |
Alignment Length: | 67 |
Identity: | 24/67 - (35%) |
Similarity: | 35/67 - (52%) |
Gaps: | 7/67 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 46 ASELTVPEDCHQP-------KETGRCFALFYRYAYNVDTQSCEEFVYGGCAGNKNNFESKEQCEQ 103
:||..|...|..| :::|.|.....||.|:.:|.:|.|:.||||.|..|||.|.::|.:
Worm 967 SSEFNVSICCQDPMDFCLSARDSGPCNNFEKRYGYDANTDTCVEYQYGGCEGTLNNFHSLQRCTE 1031
Fly 104 AC 105
.|
Worm 1032 IC 1033
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4295 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.