DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3604 and mlt-11

DIOPT Version :9

Sequence 1:NP_001285595.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001256938.1 Gene:mlt-11 / 180352 WormBaseID:WBGene00012186 Length:3129 Species:Caenorhabditis elegans


Alignment Length:165 Identity:50/165 - (30%)
Similarity:65/165 - (39%) Gaps:57/165 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RAAPSDVVVEKAE--EPAVAK---PLPDA---------------SELTVPED------------- 54
            |.||..|.:.|.|  ||...|   |:..|               |.:..||:             
 Worm   472 RCAPPPVGLPKCEIGEPLKTKIGVPVNCAKTDCPSGYRCSVVQHSSVCCPENNKVVGLQTSGARA 536

  Fly    55 --CHQPKETGRCFALFYRYAYNVDTQSCEEFVYGGCAGNKNNFESKEQCEQACLV-KSAVSSTDS 116
              |..|||.|.|.....|:.:|.|...|:.|.:|||.||:||||..|.||.||.| ||.|::..:
 Worm   537 TRCSLPKERGPCDKYELRFYFNADLNECKYFFWGGCEGNQNNFERVEDCESACGVQKSGVTNRPN 601

  Fly   117 T---------------------TEQNSEVATETST 130
            |                     ||::.|.|..|:|
 Worm   602 TEIRTTQGIRITPNGGKLSWEETEEDEEHAVPTTT 636

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG3604NP_001285595.1 KU 53..106 CDD:238057 25/67 (37%)
mlt-11NP_001256938.1 TY <361..409 CDD:238114