DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG3604 and Y43F8B.3

DIOPT Version :9

Sequence 1:	NP_001285595.1	Gene:	CG3604 / 33593	FlyBaseID:	FBgn0031562	Length:	132	Species:	Drosophila melanogaster
Sequence 2:	NP_001256874.1	Gene:	Y43F8B.3 / 180277	WormBaseID:	WBGene00012814	Length:	1658	Species:	Caenorhabditis elegans

Alignment Length:	65	Identity:	28/65 - (43%)
Similarity:	35/65 - (53%)	Gaps:	0/65 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly    52 PEDCHQPKETGRCFALFYRYAYNVDTQSCEEFVYGGCAGNKNNFESKEQCEQACLVKSAVSSTDS 116
            |:.|.||...|...|...|:.||..|..|.:|.|.|..||:|||:|::.|||.|.|...|..|.|
Worm   859 PQICQQPMAVGTGGATLPRWYYNAQTMQCVQFNYAGRMGNQNNFQSQQACEQTCPVYVNVCPTGS 923

Fly 117 116
Worm 924 923

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG3604	NP_001285595.1	KU	53..106	CDD:238057	22/52 (42%)
Y43F8B.3	NP_001256874.1	KU	76..126	CDD:238057
		KU	129..182	CDD:238057
		Kunitz_BPTI	231..282	CDD:278443
		Lustrin_cystein	287..329	CDD:291299
		Kunitz_BPTI	335..386	CDD:278443
		Lustrin_cystein	393..434	CDD:291299
		KU	438..490	CDD:197529
		Lustrin_cystein	497..540	CDD:291299
		Kunitz_BPTI	545..596	CDD:278443
		KU	649..703	CDD:238057
		KU	752..804	CDD:238057
		Lustrin_cystein	811..853	CDD:291299
		Kunitz_BPTI	861..912	CDD:278443	22/50 (44%)
		Lustrin_cystein	919..962	CDD:291299	2/5 (40%)
		Kunitz_BPTI	981..1025	CDD:278443
		Kunitz_BPTI	1076..1128	CDD:278443
		Lustrin_cystein	1132..1176	CDD:291299
		Kunitz_BPTI	1182..1234	CDD:278443
		Lustrin_cystein	1241..1282	CDD:291299
		Kunitz_BPTI	1287..1338	CDD:278443
		Kunitz_BPTI	1395..1447	CDD:278443
		Lustrin_cystein	1453..1492	CDD:291299
		Kunitz_BPTI	1499..1549	CDD:278443
		KU	1600..1652	CDD:197529
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910