DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3604 and F22E12.1

DIOPT Version :10

Sequence 1:NP_608801.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_505684.2 Gene:F22E12.1 / 179460 WormBaseID:WBGene00009058 Length:763 Species:Caenorhabditis elegans


Alignment Length:92 Identity:28/92 - (30%)
Similarity:40/92 - (43%) Gaps:20/92 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VLLLAAGIRAAPSDVVVEKAEEPAVAKPLPDASELTVPEDCHQPKETGRCFALFY-RYAYNVDTQ 78
            ||:|..|..|..|..:                  |:.|:..|.| :.|.|...|: ::.|:....
 Worm     4 VLILLFGCTAVNSQQL------------------LSNPKCNHWP-DRGTCELDFHVKWYYDRYDH 49

  Fly    79 SCEEFVYGGCAGNKNNFESKEQCEQAC 105
            .|..|.||||.||:|.|:|.|:|...|
 Worm    50 RCRRFFYGGCEGNENRFDSLEECSSQC 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3604NP_608801.1 Kunitz-type 55..105 CDD:438633 19/50 (38%)
F22E12.1NP_505684.2 Kunitz-type 25..76 CDD:438633 19/51 (37%)
KU 85..137 CDD:197529
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.