DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3604 and F30H5.3

DIOPT Version :10

Sequence 1:NP_608801.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_497206.1 Gene:F30H5.3 / 175207 WormBaseID:WBGene00017937 Length:1599 Species:Caenorhabditis elegans


Alignment Length:67 Identity:28/67 - (41%)
Similarity:33/67 - (49%) Gaps:7/67 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 VAKPLPDASELTVPEDCHQPKETGRCFALFYRYAYNVDTQSCEEFVYGGCAGNKNNFESKEQCEQ 103
            |..|.|.|.       |.||...|.|.....||.||..|::||.|.|.||.||.||||:..:|:.
 Worm   554 VCCPRPQAI-------CSQPLRLGDCKQSVRRYWYNAVTRACEIFDYTGCQGNDNNFETLLECQN 611

  Fly   104 AC 105
            .|
 Worm   612 TC 613

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3604NP_608801.1 Kunitz-type 55..105 CDD:438633 23/49 (47%)
F30H5.3NP_497206.1 EB 135..182 CDD:460294
KU 330..391 CDD:197529
KU <481..516 CDD:197529
Kunitz_BPTI 562..613 CDD:425421 23/57 (40%)
Kunitz_BPTI 669..723 CDD:425421
Kunitz_BPTI 776..829 CDD:425421
Lustrin_cystein 834..879 CDD:464222
Lustrin_cystein 885..930 CDD:464222
Lustrin_cystein 1105..1150 CDD:464222
EB 1212..1263 CDD:460294
EB 1267..1318 CDD:460294
Lustrin_cystein 1466..1511 CDD:464222
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.