DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3604 and K10D3.4

DIOPT Version :10

Sequence 1:NP_608801.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_492020.1 Gene:K10D3.4 / 172452 WormBaseID:WBGene00010738 Length:922 Species:Caenorhabditis elegans


Alignment Length:51 Identity:23/51 - (45%)
Similarity:32/51 - (62%) Gaps:0/51 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 CHQPKETGRCFALFYRYAYNVDTQSCEEFVYGGCAGNKNNFESKEQCEQAC 105
            |..|:|.|.|.....|:.:|..|.:||||:|.||.||.||||:.::|:..|
 Worm   411 CKLPREQGNCGTYSNRWWFNAKTGNCEEFIYSGCQGNANNFETYKECQDYC 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3604NP_608801.1 Kunitz-type 55..105 CDD:438633 22/49 (45%)
K10D3.4NP_492020.1 EB 46..100 CDD:460294
Kunitz_BPTI 170..226 CDD:425421
KU <312..352 CDD:197529
Kunitz_BPTI 410..462 CDD:425421 23/51 (45%)
Kunitz_BPTI 518..571 CDD:425421
Kunitz_BPTI 628..681 CDD:425421
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.