DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3604 and K10D3.4

DIOPT Version :9

Sequence 1:NP_001285595.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_492020.1 Gene:K10D3.4 / 172452 WormBaseID:WBGene00010738 Length:922 Species:Caenorhabditis elegans


Alignment Length:51 Identity:23/51 - (45%)
Similarity:32/51 - (62%) Gaps:0/51 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 CHQPKETGRCFALFYRYAYNVDTQSCEEFVYGGCAGNKNNFESKEQCEQAC 105
            |..|:|.|.|.....|:.:|..|.:||||:|.||.||.||||:.::|:..|
 Worm   411 CKLPREQGNCGTYSNRWWFNAKTGNCEEFIYSGCQGNANNFETYKECQDYC 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3604NP_001285595.1 KU 53..106 CDD:238057 23/51 (45%)
K10D3.4NP_492020.1 EB 46..100 CDD:279949
Kunitz_BPTI 170..226 CDD:278443
KU <312..352 CDD:197529
Kunitz_BPTI 410..462 CDD:278443 23/51 (45%)
Kunitz_BPTI 518..571 CDD:278443
Kunitz_BPTI 628..681 CDD:278443
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.