DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3604 and CG43703

DIOPT Version :10

Sequence 1:NP_608801.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001260009.1 Gene:CG43703 / 14462687 FlyBaseID:FBgn0263842 Length:84 Species:Drosophila melanogaster


Alignment Length:54 Identity:12/54 - (22%)
Similarity:19/54 - (35%) Gaps:4/54 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 CHQPKETGRCFAL---FYRYAYNVDTQSCEEFVYGGCAGNKNNFESKEQCEQAC 105
            |.......||.:.   ...|.|:.....|.: :...|......|.:||.|::.|
  Fly    25 CGLKPRVNRCISAKESLVLYGYSESRNICYK-IKNPCQTLVRRFATKEICQKLC 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3604NP_608801.1 Kunitz-type 55..105 CDD:438633 11/52 (21%)
CG43703NP_001260009.1 None

Return to query results.
Submit another query.