DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3604 and C49H3.16

DIOPT Version :9

Sequence 1:NP_001285595.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001255308.1 Gene:C49H3.16 / 13196868 WormBaseID:WBGene00219436 Length:206 Species:Caenorhabditis elegans


Alignment Length:98 Identity:34/98 - (34%)
Similarity:47/98 - (47%) Gaps:9/98 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FAAVL-LLAAGIRAAPSDVVVEKAEEPAVAKPLPDASELTVP---EDCHQPKETGRCFALFYRYA 72
            ||..| |...|...||:..::    .|.:...||..:..|.|   :.|..|..||.|......:.
 Worm   104 FAPFLNLFGGGTPGAPTPTLI----PPFMLPTLPTTAPPTTPSPVDVCSLPPVTGSCSRARIMWY 164

  Fly    73 YNVDTQSCEEFVYGGCAGNKNNFESKEQCEQAC 105
            |:.:::.||.|.:.|| ||:|.|.||.||||.|
 Worm   165 YDNESRRCERFSWSGC-GNQNRFASKMQCEQTC 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3604NP_001285595.1 KU 53..106 CDD:238057 22/53 (42%)
C49H3.16NP_001255308.1 PHA03247 <31..126 CDD:223021 7/25 (28%)
PRK10856 <60..>106 CDD:236776 1/1 (100%)
KU 145..196 CDD:238057 21/51 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000145
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X627
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.