DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3604 and WFIKKN2

DIOPT Version :10

Sequence 1:NP_608801.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_783165.1 Gene:WFIKKN2 / 124857 HGNCID:30916 Length:576 Species:Homo sapiens


Alignment Length:51 Identity:28/51 - (54%)
Similarity:33/51 - (64%) Gaps:0/51 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 CHQPKETGRCFALFYRYAYNVDTQSCEEFVYGGCAGNKNNFESKEQCEQAC 105
            |..|...|.|.|...|:|||..|..|:.||||||.||.|||||:|.||::|
Human   386 CSLPALQGPCKAYAPRWAYNSQTGQCQSFVYGGCEGNGNNFESREACEESC 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3604NP_608801.1 Kunitz-type 55..105 CDD:438633 27/49 (55%)
WFIKKN2NP_783165.1 WAP 42..91 CDD:459672
KAZAL_FS 138..174 CDD:238052
IgI_3_WFIKKN-like 210..304 CDD:409422
Ig strand A 210..213 CDD:409422
Ig strand A' 218..221 CDD:409422
Ig strand B 226..233 CDD:409422
Ig strand C 240..245 CDD:409422
Ig strand C' 246..248 CDD:409422
Ig strand D 250..255 CDD:409422
Ig strand E 263..269 CDD:409422
Ig strand F 283..291 CDD:409422
Ig strand G 294..304 CDD:409422
Kunitz_WFIKKN_1-like 327..378 CDD:438648
Kunitz_WFIKKN_2-like 385..437 CDD:438649 28/51 (55%)
NTR_WFIKKN 455..563 CDD:239630
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.