DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3604 and Aplp2

DIOPT Version :9

Sequence 1:NP_001285595.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001344627.1 Gene:Aplp2 / 11804 MGIID:88047 Length:763 Species:Mus musculus


Alignment Length:106 Identity:34/106 - (32%)
Similarity:52/106 - (49%) Gaps:12/106 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KAEEPAVAKPLPDASELTVPED---------CHQPKETGRCFALFYRYAYNVDTQSCEEFVYGGC 88
            |.::.....|...:||.|:.:.         |.|...||.|.|:..|:.:::....|..|:||||
Mouse   279 KGDDYNEENPTEPSSEGTISDKEIVHDVKAVCSQEAMTGPCRAVMPRWYFDLSKGKCVRFIYGGC 343

  Fly    89 AGNKNNFESKEQCEQACLVKSAVSSTDSTTEQNSEVATETS 129
            .||:|||||::.|...|  |:.:..|...| .:.:|..|||
Mouse   344 GGNRNNFESEDYCMAVC--KAMIPPTPLPT-NDVDVYFETS 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3604NP_001285595.1 KU 53..106 CDD:238057 21/61 (34%)
Aplp2NP_001344627.1 A4_EXTRA 42..204 CDD:128326
Kunitz_BPTI 309..361 CDD:278443 22/53 (42%)
APP_E2 365..547 CDD:315580 6/18 (33%)
APP_amyloid 709..759 CDD:313694
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.