DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3604 and SPINT3

DIOPT Version :9

Sequence 1:NP_001285595.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_006643.1 Gene:SPINT3 / 10816 HGNCID:11248 Length:89 Species:Homo sapiens


Alignment Length:105 Identity:36/105 - (34%)
Similarity:49/105 - (46%) Gaps:19/105 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCFRYSFSFIVFAAVLLLAAGIRAAPSDVVVEKAEEPAVAKPLPDASELTVPEDCHQPKETGRCF 65
            |..:.|.||::   :|.|...:|:       |.|.         |..:..:|..|..|.|.|.|.
Human     1 MQLQASLSFLL---ILTLCLELRS-------ELAR---------DTIKDLLPNVCAFPMEKGPCQ 46

  Fly    66 ALFYRYAYNVDTQSCEEFVYGGCAGNKNNFESKEQCEQAC 105
            ....|:.:|.:|..||.|.||||.||.|||..||:||:.|
Human    47 TYMTRWFFNFETGECELFAYGGCGGNSNNFLRKEKCEKFC 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3604NP_001285595.1 KU 53..106 CDD:238057 25/53 (47%)
SPINT3NP_006643.1 KU 34..87 CDD:238057 25/53 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9940
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564520at2759
OrthoFinder 1 1.000 - - FOG0000145
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.