DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3604 and EPPIN-WFDC6

DIOPT Version :9

Sequence 1:NP_001285595.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001185915.1 Gene:EPPIN-WFDC6 / 100526773 HGNCID:38825 Length:179 Species:Homo sapiens


Alignment Length:81 Identity:32/81 - (39%)
Similarity:40/81 - (49%) Gaps:10/81 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LTVPED-CHQPKETGRCFALFYRYAYNVDTQSCEEFVYGGCAGNKNNFESKEQCEQAC------- 105
            |.:.:| |..|||||.|.|.|..:.|:....:|..||||||.||.|||:||..|...|       
Human    70 LDLKQDVCEMPKETGPCLAYFLHWWYDKKDNTCSMFVYGGCQGNNNNFQSKANCLNTCKNKQPCP 134

  Fly   106 --LVKSAVSSTDSTTE 119
              .|:..|...|..|:
Human   135 KIKVECEVEEIDQCTK 150

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG3604NP_001285595.1 KU 53..106 CDD:238057 27/62 (44%)