DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3604 and LOC100485348

DIOPT Version :10

Sequence 1:NP_608801.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster
Sequence 2:XP_031750923.1 Gene:LOC100485348 / 100485348 XenbaseID:XB-GENE-29077767 Length:206 Species:Xenopus tropicalis


Alignment Length:120 Identity:24/120 - (20%)
Similarity:41/120 - (34%) Gaps:32/120 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PKILITGGLGQLGVECAKLLRSQYGEESVILSDIIKPSSEIVNSGPYIFADILDFKGLQKIVVDH 110
            |.::..|.:.|..:|.      :...:::.:.|.......|....|.:|....|      .|:|.
 Frog   162 PLLMDLGSMNQARMEV------KDSRQAMAVQDWAAQRCTISYRAPELFNVSSD------CVIDE 214

  Fly   111 RVD-WIIHFSALLSAIGE----------QNVPLAVRVNI---------EGMHNVL 145
            |.| |.:.........||          .:|.|||:.||         :|:..:|
 Frog   215 RTDIWSLGCVLFSMMFGEGPYDMIFQKGDSVALAVQNNITVPANERYSQGLQTLL 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3604NP_608801.1 Kunitz-type 55..105 CDD:438633 7/49 (14%)
LOC100485348XP_031750923.1 Kunitz-type 23..75 CDD:444694
Kunitz-type 87..140 CDD:444694
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.