DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3604 and si:dkeyp-73b11.8

DIOPT Version :9

Sequence 1:NP_001285595.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001373612.1 Gene:si:dkeyp-73b11.8 / 100333708 ZFINID:ZDB-GENE-131120-176 Length:230 Species:Danio rerio


Alignment Length:68 Identity:24/68 - (35%)
Similarity:35/68 - (51%) Gaps:5/68 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 CHQPKETGRCFALFYRYAYNVDTQSCEEFVYGGCAGNKNNFESKEQCEQACLVKSAVSSTDSTTE 119
            |..|:|.|:||..:.||.|:.:..:|:.|.:.||.||.|.|.|..:|...|     .:|.|...|
Zfish    93 CVLPREPGQCFGHYLRYYYSPEHHTCKPFYWTGCVGNGNRFLSLNRCNATC-----YNSADKGHE 152

  Fly   120 QNS 122
            .:|
Zfish   153 DHS 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3604NP_001285595.1 KU 53..106 CDD:238057 19/50 (38%)
si:dkeyp-73b11.8NP_001373612.1 Kunitz_BPTI 26..77 CDD:394972
KU 92..143 CDD:238057 19/49 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000145
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X627
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.