DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3604 and si:dkeyp-73b11.8

DIOPT Version :10

Sequence 1:NP_608801.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001373612.1 Gene:si:dkeyp-73b11.8 / 100333708 ZFINID:ZDB-GENE-131120-176 Length:230 Species:Danio rerio


Alignment Length:68 Identity:24/68 - (35%)
Similarity:35/68 - (51%) Gaps:5/68 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 CHQPKETGRCFALFYRYAYNVDTQSCEEFVYGGCAGNKNNFESKEQCEQACLVKSAVSSTDSTTE 119
            |..|:|.|:||..:.||.|:.:..:|:.|.:.||.||.|.|.|..:|...|     .:|.|...|
Zfish    93 CVLPREPGQCFGHYLRYYYSPEHHTCKPFYWTGCVGNGNRFLSLNRCNATC-----YNSADKGHE 152

  Fly   120 QNS 122
            .:|
Zfish   153 DHS 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3604NP_608801.1 Kunitz-type 55..105 CDD:438633 19/49 (39%)
si:dkeyp-73b11.8NP_001373612.1 Kunitz_conkunitzin 27..77 CDD:438636
Kunitz_BPTI 92..143 CDD:425421 19/49 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.