DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IM33 and WFDC8

DIOPT Version :10

Sequence 1:NP_608800.1 Gene:IM33 / 33592 FlyBaseID:FBgn0031561 Length:82 Species:Drosophila melanogaster
Sequence 2:XP_016883608.1 Gene:WFDC8 / 90199 HGNCID:16163 Length:247 Species:Homo sapiens


Alignment Length:76 Identity:22/76 - (28%)
Similarity:28/76 - (36%) Gaps:11/76 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CLMFALVAVALGLKDPI---CGLPAGIDGNGLIKCAAFIPSFSYHPETNSCEKFIYGGCGGNENR 69
            |..||.....:   ||.   |.||.. .||    |......:.:..:...|..|.|.||.||.|.
Human    78 CCFFACQKKCM---DPFQEPCMLPVR-HGN----CNHEAQRWHFDFKNYRCTPFKYRGCEGNANN 134

  Fly    70 FGTQELCEQKC 80
            |..::.|...|
Human   135 FLNEDACRTAC 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IM33NP_608800.1 Kunitz_SCI-I-like 24..80 CDD:438677 16/58 (28%)
WFDC8XP_016883608.1 WAP 47..90 CDD:459672 3/14 (21%)
KU 93..145 CDD:197529 16/56 (29%)
WAP 150..190 CDD:459672
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.