DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IM33 and Spint4

DIOPT Version :10

Sequence 1:NP_608800.1 Gene:IM33 / 33592 FlyBaseID:FBgn0031561 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_084334.1 Gene:Spint4 / 78239 MGIID:1925489 Length:159 Species:Mus musculus


Alignment Length:37 Identity:13/37 - (35%)
Similarity:19/37 - (51%) Gaps:0/37 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 FSYHPETNSCEKFIYGGCGGNENRFGTQELCEQKCKE 82
            |.|:.....|:.|::.||.||.|.|..:..|:..|.|
Mouse    57 FFYNQTAKQCQIFLFTGCNGNLNNFKLKIDCDVTCHE 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IM33NP_608800.1 Kunitz_SCI-I-like 24..80 CDD:438677 11/33 (33%)
Spint4NP_084334.1 Kunitz-type 41..91 CDD:438633 11/33 (33%)

Return to query results.
Submit another query.