DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IM33 and spint2

DIOPT Version :10

Sequence 1:NP_608800.1 Gene:IM33 / 33592 FlyBaseID:FBgn0031561 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001039077.1 Gene:spint2 / 733874 XenbaseID:XB-GENE-947329 Length:394 Species:Xenopus tropicalis


Alignment Length:61 Identity:26/61 - (42%)
Similarity:32/61 - (52%) Gaps:6/61 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LKDPICGLPAGIDGNGLIKCAAFIPSFSYHPETNSCEKFIYGGCGGNENRFGTQELCEQKC 80
            ||| .| ||..:.|    .|.|....:.|:|.|.:||.|.||||.||.|....:|:|..||
 Frog   115 LKD-FC-LPEAVTG----PCRAAFERWWYNPNTQTCENFTYGGCKGNLNNHIGEEVCMNKC 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IM33NP_608800.1 Kunitz_SCI-I-like 24..80 CDD:438677 21/55 (38%)
spint2NP_001039077.1 MANEC 19..104 CDD:471454
Kunitz-type 117..169 CDD:444694 22/57 (39%)
Kunitz-type 195..246 CDD:444694
Kunitz-type 266..318 CDD:444694
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.