DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IM33 and Wfdc8

DIOPT Version :10

Sequence 1:NP_608800.1 Gene:IM33 / 33592 FlyBaseID:FBgn0031561 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001400645.1 Gene:Wfdc8 / 685170 RGDID:1597713 Length:272 Species:Rattus norvegicus


Alignment Length:73 Identity:21/73 - (28%)
Similarity:32/73 - (43%) Gaps:5/73 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CLMFALVAVALGLKDPICGLPAGIDGNGLIKCAAFIPSFSYHPETNSCEKFIYGGCGGNENRFGT 72
            |..||...:.:...:..|.||:.. ||    |...:..:.:..:.:.|..|.|.|||||.|.|.:
  Rat   104 CCHFACGRLCMDPYEEPCLLPSDA-GN----CKDTLTHWYFDSQKHKCRAFTYSGCGGNSNNFLS 163

  Fly    73 QELCEQKC 80
            :..|...|
  Rat   164 KADCRNAC 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IM33NP_608800.1 Kunitz_SCI-I-like 24..80 CDD:438677 17/55 (31%)
Wfdc8NP_001400645.1 WAP 73..116 CDD:459672 3/11 (27%)
Kunitz-type 121..171 CDD:438633 17/54 (31%)
WAP 176..216 CDD:459672
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.