| Sequence 1: | NP_608800.1 | Gene: | IM33 / 33592 | FlyBaseID: | FBgn0031561 | Length: | 82 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_857593.1 | Gene: | SPINT1 / 6692 | HGNCID: | 11246 | Length: | 529 | Species: | Homo sapiens |
| Alignment Length: | 43 | Identity: | 17/43 - (39%) |
|---|---|---|---|
| Similarity: | 26/43 - (60%) | Gaps: | 0/43 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 39 CAAFIPSFSYHPETNSCEKFIYGGCGGNENRFGTQELCEQKCK 81 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| IM33 | NP_608800.1 | Kunitz_SCI-I-like | 24..80 | CDD:438677 | 16/40 (40%) |
| SPINT1 | NP_857593.1 | MANEC | 50..139 | CDD:462186 | |
| Kunitz_HAI1_1-like | 245..303 | CDD:438666 | |||
| LDLa | 334..366 | CDD:197566 | |||
| Kunitz_HAI1_2-like | 390..450 | CDD:438667 | 17/43 (40%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||