DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IM33 and Spint3

DIOPT Version :10

Sequence 1:NP_608800.1 Gene:IM33 / 33592 FlyBaseID:FBgn0031561 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001170872.1 Gene:Spint3 / 629747 MGIID:3651470 Length:88 Species:Mus musculus


Alignment Length:58 Identity:24/58 - (41%)
Similarity:31/58 - (53%) Gaps:5/58 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PICGLPAGIDGNGLIKCAAFIPSFSYHPETNSCEKFIYGGCGGNENRFGTQELCEQKC 80
            |:|.||..|.|     |.|....:.|:.:|..||.|.||||.||||.|.::..|:..|
Mouse    33 PMCILPKDIGG-----CRAVFVRWYYNSKTGKCEWFRYGGCKGNENNFPSRSQCQAVC 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IM33NP_608800.1 Kunitz_SCI-I-like 24..80 CDD:438677 22/55 (40%)
Spint3NP_001170872.1 Kunitz_actitoxin-like 31..85 CDD:438676 23/56 (41%)

Return to query results.
Submit another query.