DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IM33 and spint2

DIOPT Version :10

Sequence 1:NP_608800.1 Gene:IM33 / 33592 FlyBaseID:FBgn0031561 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001070718.2 Gene:spint2 / 562009 ZFINID:ZDB-GENE-061013-323 Length:431 Species:Danio rerio


Alignment Length:56 Identity:26/56 - (46%)
Similarity:31/56 - (55%) Gaps:5/56 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CGLPAGIDGNGLIKCAAFIPSFSYHPETNSCEKFIYGGCGGNENRFGTQELCEQKC 80
            |..|:.: ||    |.|..|.|.|.....:|:.|||||||||||.|.:|..||..|
Zfish   133 CRFPSAV-GN----CRAAFPRFFYDITDQTCKSFIYGGCGGNENNFYSQAECEASC 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IM33NP_608800.1 Kunitz_SCI-I-like 24..80 CDD:438677 25/54 (46%)
spint2NP_001070718.2 MANEC <56..108 CDD:471454
Kunitz-type 133..183 CDD:438633 25/54 (46%)
Kunitz-type 228..276 CDD:438633
Kunitz-type 302..354 CDD:444694
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.