DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IM33 and col28a1a

DIOPT Version :10

Sequence 1:NP_608800.1 Gene:IM33 / 33592 FlyBaseID:FBgn0031561 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001334976.1 Gene:col28a1a / 555428 ZFINID:ZDB-GENE-070705-84 Length:1170 Species:Danio rerio


Alignment Length:61 Identity:24/61 - (39%)
Similarity:34/61 - (55%) Gaps:5/61 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LKDPICGLPAGIDGNGLIKCAAFIPSFSYHPETNSCEKFIYGGCGGNENRFGTQELCEQKC 80
            ||...||  .|:|..   .|..:...:.|.|:.|:|.:|.||||.||.|||.|:::|:..|
Zfish  1112 LKHVGCG--QGLDPG---PCREYSVMWYYDPQANACAQFWYGGCQGNSNRFETEDICKSTC 1167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IM33NP_608800.1 Kunitz_SCI-I-like 24..80 CDD:438677 21/55 (38%)
col28a1aNP_001334976.1 vWFA_subfamily_ECM 49..214 CDD:238727
gly_rich_SclB <246..>551 CDD:468478
gly_rich_SclB <482..>766 CDD:468478
VWA 802..980 CDD:459670
Kunitz_collagen_alpha1_XXVIII 1117..1167 CDD:438671 21/54 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.