DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IM33 and CG14298

DIOPT Version :10

Sequence 1:NP_608800.1 Gene:IM33 / 33592 FlyBaseID:FBgn0031561 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_650755.1 Gene:CG14298 / 42259 FlyBaseID:FBgn0038654 Length:111 Species:Drosophila melanogaster


Alignment Length:70 Identity:19/70 - (27%)
Similarity:28/70 - (40%) Gaps:22/70 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 GNGLIKCAAFIPSFSYHPETNS----------------------CEKFIYGGCGGNENRFGTQEL 75
            |||.:.....:.:|:.:...|.                      |:.|.|.||.||.|||.:||.
  Fly    40 GNGAVVSCKELNNFNCYVGRNEGNFCSRKDQTKVVTRWYFDKGVCKPFNYKGCNGNRNRFCSQES 104

  Fly    76 CEQKC 80
            |:.:|
  Fly   105 CDARC 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IM33NP_608800.1 Kunitz_SCI-I-like 24..80 CDD:438677 18/68 (26%)
CG14298NP_650755.1 Kunitz-type <74..109 CDD:438633 13/34 (38%)

Return to query results.
Submit another query.