DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IM33 and spint1a

DIOPT Version :10

Sequence 1:NP_608800.1 Gene:IM33 / 33592 FlyBaseID:FBgn0031561 Length:82 Species:Drosophila melanogaster
Sequence 2:XP_073783238.1 Gene:spint1a / 406426 ZFINID:ZDB-GENE-040426-2169 Length:523 Species:Danio rerio


Alignment Length:67 Identity:22/67 - (32%)
Similarity:30/67 - (44%) Gaps:11/67 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VAVALGLKDPICGLPAGIDGNGLIKCAAFIPSFSYHPETNSCEKFIYGGCGGNENRFGTQELCEQ 78
            |:.|..:|.|:.|           .|......:.|:|....|.:|.||||.||:|||.|:..|..
Zfish   380 VSKARCVKPPVTG-----------TCPGSQTKWYYNPNKRLCYRFNYGGCEGNQNRFETEAGCMT 433

  Fly    79 KC 80
            .|
Zfish   434 FC 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IM33NP_608800.1 Kunitz_SCI-I-like 24..80 CDD:438677 17/55 (31%)
spint1aXP_073783238.1 None

Return to query results.
Submit another query.