DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IM33 and SPINT4

DIOPT Version :10

Sequence 1:NP_608800.1 Gene:IM33 / 33592 FlyBaseID:FBgn0031561 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_848550.1 Gene:SPINT4 / 391253 HGNCID:16130 Length:99 Species:Homo sapiens


Alignment Length:75 Identity:21/75 - (28%)
Similarity:33/75 - (44%) Gaps:8/75 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FIAAVCLMFALVAVALG----LKDPICG---LPAGIDGNGLIKCAAFIPSFSYHPETNSCEKFIY 60
            |:....:..:|..:.||    :.:.|||   .|..:|.| ...|......:.|:..:..||.|::
Human     8 FLLRFFIFCSLNTLLLGGVNKIAEKICGDLKDPCKLDMN-FGSCYEVHFRYFYNRTSKRCETFVF 71

  Fly    61 GGCGGNENRF 70
            .||.||.|.|
Human    72 SGCNGNLNNF 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IM33NP_608800.1 Kunitz_SCI-I-like 24..80 CDD:438677 17/50 (34%)
SPINT4NP_848550.1 Kunitz-type 41..91 CDD:438633 13/42 (31%)

Return to query results.
Submit another query.