DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IM33 and tfpia

DIOPT Version :10

Sequence 1:NP_608800.1 Gene:IM33 / 33592 FlyBaseID:FBgn0031561 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001296732.1 Gene:tfpia / 359833 ZFINID:ZDB-GENE-030711-1 Length:279 Species:Danio rerio


Alignment Length:43 Identity:16/43 - (37%)
Similarity:27/43 - (62%) Gaps:0/43 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 CAAFIPSFSYHPETNSCEKFIYGGCGGNENRFGTQELCEQKCK 81
            |...:|.:.:..::..|::|.||||.||.|.|.|.:.|:|:|:
Zfish   110 CRGLVPRYFFDQKSQECKQFFYGGCFGNANNFKTIKACQQRCQ 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IM33NP_608800.1 Kunitz_SCI-I-like 24..80 CDD:438677 15/40 (38%)
tfpiaNP_001296732.1 Kunitz_TFPI1_1-like 39..93 CDD:438656
Kunitz-type 101..151 CDD:438633 15/40 (38%)
Kunitz-type 202..255 CDD:444694
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.