| Sequence 1: | NP_608800.1 | Gene: | IM33 / 33592 | FlyBaseID: | FBgn0031561 | Length: | 82 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001296732.1 | Gene: | tfpia / 359833 | ZFINID: | ZDB-GENE-030711-1 | Length: | 279 | Species: | Danio rerio |
| Alignment Length: | 43 | Identity: | 16/43 - (37%) |
|---|---|---|---|
| Similarity: | 27/43 - (62%) | Gaps: | 0/43 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 39 CAAFIPSFSYHPETNSCEKFIYGGCGGNENRFGTQELCEQKCK 81 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| IM33 | NP_608800.1 | Kunitz_SCI-I-like | 24..80 | CDD:438677 | 15/40 (38%) |
| tfpia | NP_001296732.1 | Kunitz_TFPI1_1-like | 39..93 | CDD:438656 | |
| Kunitz-type | 101..151 | CDD:438633 | 15/40 (38%) | ||
| Kunitz-type | 202..255 | CDD:444694 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||