DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IM33 and K12G11.6

DIOPT Version :10

Sequence 1:NP_608800.1 Gene:IM33 / 33592 FlyBaseID:FBgn0031561 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001024057.2 Gene:K12G11.6 / 3565780 WormBaseID:WBGene00010792 Length:186 Species:Caenorhabditis elegans


Alignment Length:78 Identity:22/78 - (28%)
Similarity:36/78 - (46%) Gaps:10/78 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AVCLMFALVAVALGLKDPICGLPAGIDGNGLIKCAAFIPSFSYH--PETNSCEKFIYGGCGGNEN 68
            ::.::..|.:::...:||        ...|..||.....|..|:  .:...|..|:|.|||||.|
 Worm     6 SMLIVLCLFSLSHSCQDP--------PNRGHTKCGKAQKSIKYYFDKKLEMCLPFLYSGCGGNTN 62

  Fly    69 RFGTQELCEQKCK 81
            ||...|:|..:|:
 Worm    63 RFDDSEMCNLRCR 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IM33NP_608800.1 Kunitz_SCI-I-like 24..80 CDD:438677 18/57 (32%)
K12G11.6NP_001024057.2 KU 20..74 CDD:197529 20/61 (33%)

Return to query results.
Submit another query.