DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IM33 and COL28A1

DIOPT Version :10

Sequence 1:NP_608800.1 Gene:IM33 / 33592 FlyBaseID:FBgn0031561 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001032852.2 Gene:COL28A1 / 340267 HGNCID:22442 Length:1125 Species:Homo sapiens


Alignment Length:62 Identity:22/62 - (35%)
Similarity:35/62 - (56%) Gaps:5/62 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GLKDPICGLPAGIDGNGLIKCAAFIPSFSYHPETNSCEKFIYGGCGGNENRFGTQELCEQKC 80
            |.:||.| |.|...||    |..::..:.|..:.|||.:|.:.||.|:.|||.:::.|::.|
Human  1066 GAEDPRC-LEALKPGN----CGEYVVRWYYDKQVNSCARFWFSGCNGSGNRFNSEKECQETC 1122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IM33NP_608800.1 Kunitz_SCI-I-like 24..80 CDD:438677 18/55 (33%)
COL28A1NP_001032852.2 vWFA_subfamily_ECM 47..209 CDD:238727
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..769
gly_rich_SclB <272..>582 CDD:468478
gly_rich_SclB <478..>759 CDD:468478
VWA 798..974 CDD:459670
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 999..1066 22/62 (35%)
Kunitz-type 1072..1122 CDD:444694 18/54 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.