DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IM33 and CG16713

DIOPT Version :10

Sequence 1:NP_608800.1 Gene:IM33 / 33592 FlyBaseID:FBgn0031561 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster


Alignment Length:80 Identity:45/80 - (56%)
Similarity:57/80 - (71%) Gaps:0/80 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFIAAVCLMFALVAVALGLKDPICGLPAGIDGNGLIKCAAFIPSFSYHPETNSCEKFIYGGCGG 65
            ||.:..|.:..|.||.||.||:.|||||..::|:|.|.|.|:|||:||..:.|.|.|||||||||
  Fly     1 MKLLILVFVFVAFVANALALKNAICGLPHSLNGDGRISCEAYIPSWSYDADRNECVKFIYGGCGG 65

  Fly    66 NENRFGTQELCEQKC 80
            |.|||.::|:||.||
  Fly    66 NNNRFNSREICEDKC 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IM33NP_608800.1 Kunitz_SCI-I-like 24..80 CDD:438677 33/55 (60%)
CG16713NP_608799.1 Kunitz_SCI-I-like 24..80 CDD:438677 33/55 (60%)

Return to query results.
Submit another query.