DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IM33 and CG15418

DIOPT Version :10

Sequence 1:NP_608800.1 Gene:IM33 / 33592 FlyBaseID:FBgn0031561 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_608794.1 Gene:CG15418 / 33585 FlyBaseID:FBgn0031554 Length:97 Species:Drosophila melanogaster


Alignment Length:37 Identity:16/37 - (43%)
Similarity:23/37 - (62%) Gaps:0/37 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 FSYHPETNSCEKFIYGGCGGNENRFGTQELCEQKCKE 82
            ::|:.:|.:||.|||.||...||.|.|.|.|.:.|.:
  Fly    57 YAYNKKTGNCESFIYTGCASTENNFLTFEECRRDCMQ 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IM33NP_608800.1 Kunitz_SCI-I-like 24..80 CDD:438677 15/33 (45%)
CG15418NP_608794.1 Kunitz-type 41..91 CDD:438633 15/33 (45%)

Return to query results.
Submit another query.