DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IM33 and LOC3292058

DIOPT Version :10

Sequence 1:NP_608800.1 Gene:IM33 / 33592 FlyBaseID:FBgn0031561 Length:82 Species:Drosophila melanogaster
Sequence 2:XP_553610.4 Gene:LOC3292058 / 3292058 VectorBaseID:AGAMI1_012805 Length:155 Species:Anopheles gambiae


Alignment Length:63 Identity:23/63 - (36%)
Similarity:31/63 - (49%) Gaps:9/63 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KDPICGLP--AGIDGNGLIKCAAFIPSFSYHPETNSCEKFIYGGCGGNENRFGTQELCEQKCK 81
            :|..|.||  .|:       |.|.:|.|.|.|....|.:|.:|||.||.|.|.:.:.|.:.||
Mosquito    98 RDEQCKLPPRRGV-------CRALLPRFRYDPAQKECIEFKFGGCDGNANNFMSYKQCMEACK 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IM33NP_608800.1 Kunitz_SCI-I-like 24..80 CDD:438677 20/57 (35%)
LOC3292058XP_553610.4 None

Return to query results.
Submit another query.