DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IM33 and Acp24A4

DIOPT Version :10

Sequence 1:NP_608800.1 Gene:IM33 / 33592 FlyBaseID:FBgn0031561 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster


Alignment Length:82 Identity:38/82 - (46%)
Similarity:48/82 - (58%) Gaps:4/82 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFIAAVCLMFALVAVALGLKDPICGLPAGIDGNGLIKCAAFIPSFSYHPETNSCEKFIYGGCGG 65
            ||.:..:.:..||.:.:|.||:.||||||..:||    |.|....:||..:.|.|..||||||.|
  Fly     1 MKLLILLFVFIALASNSLALKNEICGLPAAANGN----CLALFSRWSYDAQYNVCFNFIYGGCQG 61

  Fly    66 NENRFGTQELCEQKCKE 82
            |||.|.:||.|..||.|
  Fly    62 NENSFESQEECINKCVE 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IM33NP_608800.1 Kunitz_SCI-I-like 24..80 CDD:438677 28/55 (51%)
Acp24A4NP_001036330.1 Kunitz-type 25..76 CDD:438633 27/54 (50%)

Return to query results.
Submit another query.