DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IM33 and Col28a1

DIOPT Version :10

Sequence 1:NP_608800.1 Gene:IM33 / 33592 FlyBaseID:FBgn0031561 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001032954.1 Gene:Col28a1 / 213945 MGIID:2685312 Length:1141 Species:Mus musculus


Alignment Length:62 Identity:20/62 - (32%)
Similarity:32/62 - (51%) Gaps:9/62 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KDPIC--GLPAGIDGNGLIKCAAFIPSFSYHPETNSCEKFIYGGCGGNENRFGTQELCEQKC 80
            |||.|  .|..|       :|..::..:.|..:.|||.:|.:.||.|:.|||.:::.|.:.|
Mouse  1084 KDPRCEEALKPG-------ECGDYVVRWYYDKQVNSCARFWFSGCNGSGNRFHSEKECRETC 1138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IM33NP_608800.1 Kunitz_SCI-I-like 24..80 CDD:438677 16/57 (28%)
Col28a1NP_001032954.1 vWFA_subfamily_ECM 47..212 CDD:238727
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..770
gly_rich_SclB <257..446 CDD:468478
gly_rich_SclB <363..632 CDD:468478
gly_rich_SclB <525..>773 CDD:468478
VWA 798..974 CDD:459670
Kunitz-type 1088..1138 CDD:444694 16/56 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.