DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IM33 and Spint1

DIOPT Version :10

Sequence 1:NP_608800.1 Gene:IM33 / 33592 FlyBaseID:FBgn0031561 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_058603.2 Gene:Spint1 / 20732 MGIID:1338033 Length:507 Species:Mus musculus


Alignment Length:43 Identity:17/43 - (39%)
Similarity:26/43 - (60%) Gaps:0/43 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 CAAFIPSFSYHPETNSCEKFIYGGCGGNENRFGTQELCEQKCK 81
            |...||.:.|:|.:..|.:|.||||.||:|.|..::.|.:.|:
Mouse   378 CKENIPRWYYNPFSERCARFTYGGCYGNKNNFEEEQQCLESCR 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IM33NP_608800.1 Kunitz_SCI-I-like 24..80 CDD:438677 16/40 (40%)
Spint1NP_058603.2 MANEC 42..133 CDD:462186
Kunitz_HAI1_1-like 239..297 CDD:438666
LDLa 313..344 CDD:197566
Kunitz_HAI1_2-like 369..428 CDD:438667 17/43 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.