DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IM33 and ZK287.4

DIOPT Version :10

Sequence 1:NP_608800.1 Gene:IM33 / 33592 FlyBaseID:FBgn0031561 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001256133.1 Gene:ZK287.4 / 191282 WormBaseID:WBGene00013965 Length:1285 Species:Caenorhabditis elegans


Alignment Length:56 Identity:23/56 - (41%)
Similarity:29/56 - (51%) Gaps:5/56 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CGLPAGIDGNGLIKCAAFIPSFSYHPETNSCEKFIYGGCGGNENRFGTQELCEQKC 80
            |.||..| |||...    ||.:.:...|..||:|.|.|..||:|||..:..||:.|
 Worm   318 CELPPAI-GNGPFN----IPRYYFDRVTKKCERFFYSGRDGNDNRFYKKNKCERLC 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IM33NP_608800.1 Kunitz_SCI-I-like 24..80 CDD:438677 22/54 (41%)
ZK287.4NP_001256133.1 Lustrin_cystein 45..91 CDD:464222
Kunitz_BPTI 99..151 CDD:425421
Kunitz_conkunitzin 257..308 CDD:438636
KU 318..368 CDD:197529 22/54 (41%)
Kunitz_conkunitzin 846..896 CDD:438636
Kunitz_conkunitzin 995..1043 CDD:438636
Kunitz_conkunitzin 1054..1104 CDD:438636
Lustrin_cystein 1148..1189 CDD:464222
KU <1215..1259 CDD:197529
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.