DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IM33 and Y49G5A.1

DIOPT Version :10

Sequence 1:NP_608800.1 Gene:IM33 / 33592 FlyBaseID:FBgn0031561 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_504413.1 Gene:Y49G5A.1 / 190090 WormBaseID:WBGene00021731 Length:182 Species:Caenorhabditis elegans


Alignment Length:82 Identity:25/82 - (30%)
Similarity:35/82 - (42%) Gaps:9/82 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFIAAVCLMFALVAVALGLKDPICGLPAGIDGNGLIKCAAFIPSFSYH--PETNSCEKFIYGGC 63
            :.|:|.:..:..||:..    .|.|.||..:   |...|........||  .::|....|.|.||
 Worm     5 LTFLATILCVSELVSTL----QPECKLPLDM---GKTPCKNGKKEIRYHFDQKSNIPLAFEYSGC 62

  Fly    64 GGNENRFGTQELCEQKC 80
            |||:|.|.|:..|...|
 Worm    63 GGNKNNFKTESECRFTC 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IM33NP_608800.1 Kunitz_SCI-I-like 24..80 CDD:438677 19/57 (33%)
Y49G5A.1NP_504413.1 Kunitz-type 25..79 CDD:438633 19/56 (34%)

Return to query results.
Submit another query.