| Sequence 1: | NP_608800.1 | Gene: | IM33 / 33592 | FlyBaseID: | FBgn0031561 | Length: | 82 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_499406.2 | Gene: | W05B2.2 / 189208 | WormBaseID: | WBGene00012271 | Length: | 1278 | Species: | Caenorhabditis elegans |
| Alignment Length: | 50 | Identity: | 18/50 - (36%) |
|---|---|---|---|
| Similarity: | 23/50 - (46%) | Gaps: | 0/50 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 32 DGNGLIKCAAFIPSFSYHPETNSCEKFIYGGCGGNENRFGTQELCEQKCK 81 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| IM33 | NP_608800.1 | Kunitz_SCI-I-like | 24..80 | CDD:438677 | 17/47 (36%) |
| W05B2.2 | NP_499406.2 | EB | 67..118 | CDD:460294 | |
| Kunitz_conkunitzin | 191..247 | CDD:438636 | |||
| KU | 305..355 | CDD:197529 | |||
| Kunitz_conkunitzin | 508..560 | CDD:438636 | |||
| KU | 613..665 | CDD:197529 | 17/47 (36%) | ||
| Lustrin_cystein | 719..764 | CDD:464222 | |||
| EB | 1210..1262 | CDD:460294 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||