DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IM33 and W05B2.2

DIOPT Version :10

Sequence 1:NP_608800.1 Gene:IM33 / 33592 FlyBaseID:FBgn0031561 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_499406.2 Gene:W05B2.2 / 189208 WormBaseID:WBGene00012271 Length:1278 Species:Caenorhabditis elegans


Alignment Length:50 Identity:18/50 - (36%)
Similarity:23/50 - (46%) Gaps:0/50 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DGNGLIKCAAFIPSFSYHPETNSCEKFIYGGCGGNENRFGTQELCEQKCK 81
            |.|..|.|......|.:...|.:|.:|.|.||.||.|.|..:..|.|.|:
 Worm   617 DANEGISCGTPSKRFYFDANTETCHQFTYLGCAGNANSFSNRVACYQFCQ 666

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IM33NP_608800.1 Kunitz_SCI-I-like 24..80 CDD:438677 17/47 (36%)
W05B2.2NP_499406.2 EB 67..118 CDD:460294
Kunitz_conkunitzin 191..247 CDD:438636
KU 305..355 CDD:197529
Kunitz_conkunitzin 508..560 CDD:438636
KU 613..665 CDD:197529 17/47 (36%)
Lustrin_cystein 719..764 CDD:464222
EB 1210..1262 CDD:460294
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.