DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IM33 and C10G8.3

DIOPT Version :10

Sequence 1:NP_608800.1 Gene:IM33 / 33592 FlyBaseID:FBgn0031561 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_504417.2 Gene:C10G8.3 / 182502 WormBaseID:WBGene00015682 Length:190 Species:Caenorhabditis elegans


Alignment Length:38 Identity:15/38 - (39%)
Similarity:21/38 - (55%) Gaps:2/38 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SFSYHPE--TNSCEKFIYGGCGGNENRFGTQELCEQKC 80
            |..|:.:  |.:|..|.|.|||.|.|.|.|.:.|.::|
 Worm    46 SIRYYMDVPTETCLAFNYTGCGHNWNNFATSQACYEEC 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IM33NP_608800.1 Kunitz_SCI-I-like 24..80 CDD:438677 14/36 (39%)
C10G8.3NP_504417.2 KU 29..83 CDD:197529 14/36 (39%)

Return to query results.
Submit another query.