DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IM33 and B0222.5

DIOPT Version :10

Sequence 1:NP_608800.1 Gene:IM33 / 33592 FlyBaseID:FBgn0031561 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_505373.1 Gene:B0222.5 / 181860 WormBaseID:WBGene00015056 Length:369 Species:Caenorhabditis elegans


Alignment Length:30 Identity:13/30 - (43%)
Similarity:16/30 - (53%) Gaps:0/30 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 ETNSCEKFIYGGCGGNENRFGTQELCEQKC 80
            ||..|..|.:.|||||:|.:.|...|...|
 Worm   212 ETFQCFPFEHKGCGGNQNSYRTSSECYFDC 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IM33NP_608800.1 Kunitz_SCI-I-like 24..80 CDD:438677 12/28 (43%)
B0222.5NP_505373.1 TY 22..84 CDD:238114
TY 87..154 CDD:238114
KU 186..241 CDD:197529 12/28 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.