DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IM33 and E01G6.1

DIOPT Version :10

Sequence 1:NP_608800.1 Gene:IM33 / 33592 FlyBaseID:FBgn0031561 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_510044.2 Gene:E01G6.1 / 181387 WormBaseID:WBGene00008449 Length:1467 Species:Caenorhabditis elegans


Alignment Length:76 Identity:23/76 - (30%)
Similarity:37/76 - (48%) Gaps:7/76 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CLMFALVAVALGLKDPICGLPAGIDGNGLIKCAAFIPS---FSYHPETNSCEKFIYGGCGGNENR 69
            |:..|.:......|:.:|.:|.    |..::||:.:.|   :.:...|.:|..|.:..||||.|.
 Worm   314 CVSNAGIQYCCPAKEKVCNMPR----NSGVQCASSMKSSNRYYFDIGTATCRSFKFTQCGGNANN 374

  Fly    70 FGTQELCEQKC 80
            ||:.|.||..|
 Worm   375 FGSLEECEGFC 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IM33NP_608800.1 Kunitz_SCI-I-like 24..80 CDD:438677 19/58 (33%)
E01G6.1NP_510044.2 WR1 289..325 CDD:214601 2/10 (20%)
Kunitz_BPTI 330..386 CDD:425421 20/60 (33%)
Kunitz_BPTI 437..492 CDD:425421
Kunitz_BPTI 541..596 CDD:425421
Lustrin_cystein 604..648 CDD:464222
Lustrin_cystein 859..902 CDD:464222
Lustrin_cystein 909..951 CDD:464222
Lustrin_cystein 1197..1239 CDD:464222
EB 1265..1321 CDD:460294
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.