| Sequence 1: | NP_608800.1 | Gene: | IM33 / 33592 | FlyBaseID: | FBgn0031561 | Length: | 82 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001256938.1 | Gene: | mlt-11 / 180352 | WormBaseID: | WBGene00012186 | Length: | 3129 | Species: | Caenorhabditis elegans |
| Alignment Length: | 59 | Identity: | 23/59 - (38%) |
|---|---|---|---|
| Similarity: | 34/59 - (57%) | Gaps: | 9/59 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 24 ICGLP--AGIDGNGLIKCAAFIPSFSYHPETNSCEKFIYGGCGGNENRFGTQELCEQKC 80 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| IM33 | NP_608800.1 | Kunitz_SCI-I-like | 24..80 | CDD:438677 | 21/57 (37%) |
| mlt-11 | NP_001256938.1 | TY | <361..409 | CDD:238114 | |
| Kunitz-type | 429..473 | CDD:438633 | |||
| Kunitz_BPTI | 538..590 | CDD:425421 | |||
| Kunitz-type | 737..787 | CDD:438633 | |||
| Kunitz_BPTI | 803..855 | CDD:425421 | |||
| Kunitz_BPTI | 865..917 | CDD:425421 | |||
| Kunitz-type | 1083..1133 | CDD:438633 | |||
| Kunitz_BPTI | 2176..2228 | CDD:425421 | 23/59 (39%) | ||
| Kunitz_ixolaris_2 | 2241..2291 | CDD:438669 | |||
| Kunitz_BPTI | 2742..2793 | CDD:425421 | |||
| Lustrin_cystein | 2910..2956 | CDD:464222 | |||
| Kunitz_BPTI | 3070..3128 | CDD:425421 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||