DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IM33 and Y43F8B.3

DIOPT Version :10

Sequence 1:NP_608800.1 Gene:IM33 / 33592 FlyBaseID:FBgn0031561 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001256874.1 Gene:Y43F8B.3 / 180277 WormBaseID:WBGene00012814 Length:1658 Species:Caenorhabditis elegans


Alignment Length:60 Identity:26/60 - (43%)
Similarity:35/60 - (58%) Gaps:8/60 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DPICGLP-AGIDGNGLIKCAAFIPSFSYHPETNSCEKFIYGGCGGNENRFGTQELCEQKC 80
            || |.|| |...||      .|:..|.|:.:|.||::|.|.|..||:|.|.||:.||::|
 Worm  1075 DP-CSLPLARGSGN------QFMDRFYYNQQTGSCQQFTYSGLHGNQNNFLTQQACEEQC 1127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IM33NP_608800.1 Kunitz_SCI-I-like 24..80 CDD:438677 23/56 (41%)
Y43F8B.3NP_001256874.1 Kunitz-type 76..126 CDD:438633
Kunitz-type 131..181 CDD:438633
Kunitz_conkunitzin 232..282 CDD:438636
Lustrin_cystein 286..329 CDD:464222
Kunitz_conkunitzin 336..386 CDD:438636
Kunitz_conkunitzin 440..490 CDD:438636
Lustrin_cystein 497..540 CDD:464222
Kunitz_conkunitzin 546..596 CDD:438636
Kunitz_conkunitzin 651..702 CDD:438636
Kunitz_conkunitzin 754..804 CDD:438636
Lustrin_cystein 810..853 CDD:464222
Kunitz_conkunitzin 862..912 CDD:438636
Lustrin_cystein 918..962 CDD:464222
Kunitz_conkunitzin 973..1025 CDD:438636
Kunitz_conkunitzin 1077..1127 CDD:438636 23/55 (42%)
Lustrin_cystein 1131..1176 CDD:464222
Kunitz_conkunitzin 1183..1233 CDD:438636
Lustrin_cystein 1244..1282 CDD:464222
Kunitz_conkunitzin 1288..1338 CDD:438636
Kunitz_conkunitzin 1396..1446 CDD:438636
Kunitz_conkunitzin 1499..1549 CDD:438636
Kunitz-type 1602..1652 CDD:438633
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.