DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IM33 and F22E12.1

DIOPT Version :10

Sequence 1:NP_608800.1 Gene:IM33 / 33592 FlyBaseID:FBgn0031561 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_505684.2 Gene:F22E12.1 / 179460 WormBaseID:WBGene00009058 Length:763 Species:Caenorhabditis elegans


Alignment Length:54 Identity:18/54 - (33%)
Similarity:25/54 - (46%) Gaps:17/54 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PSFSYHPETNSCE-----------------KFIYGGCGGNENRFGTQELCEQKC 80
            |..::.|:..:||                 :|.||||.||||||.:.|.|..:|
 Worm    23 PKCNHWPDRGTCELDFHVKWYYDRYDHRCRRFFYGGCEGNENRFDSLEECSSQC 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IM33NP_608800.1 Kunitz_SCI-I-like 24..80 CDD:438677 17/52 (33%)
F22E12.1NP_505684.2 Kunitz-type 25..76 CDD:438633 16/50 (32%)
KU 85..137 CDD:197529
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.