DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IM33 and Y57A10A.24

DIOPT Version :10

Sequence 1:NP_608800.1 Gene:IM33 / 33592 FlyBaseID:FBgn0031561 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001370094.1 Gene:Y57A10A.24 / 174864 WormBaseID:WBGene00013264 Length:520 Species:Caenorhabditis elegans


Alignment Length:36 Identity:13/36 - (36%)
Similarity:18/36 - (50%) Gaps:2/36 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IAAVCLMF--ALVAVALGLKDPICGLPAGIDGNGLI 37
            :..||..|  :.|.|.....|.|||:.:.|..|||:
 Worm   188 VQGVCAKFRTSNVEVCCQSSDDICGVGSQILMNGLV 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IM33NP_608800.1 Kunitz_SCI-I-like 24..80 CDD:438677 7/14 (50%)
Y57A10A.24NP_001370094.1 Lustrin_cystein 470..513 CDD:464222
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.