DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IM33 and axo

DIOPT Version :10

Sequence 1:NP_608800.1 Gene:IM33 / 33592 FlyBaseID:FBgn0031561 Length:82 Species:Drosophila melanogaster
Sequence 2:XP_061506652.1 Gene:axo / 1277107 VectorBaseID:AGAMI1_007650 Length:2097 Species:Anopheles gambiae


Alignment Length:59 Identity:24/59 - (40%)
Similarity:32/59 - (54%) Gaps:6/59 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PICGLPAGIDGNGLIKCAAFIPSFSYHPETNSCEKFIYGGCGGN-ENRFGTQELCEQKC 80
            |.|..| |..|    :|..|...:.:....|:|.:||:|||||| :|.|.|.|.|.|:|
Mosquito    41 PKCTGP-GEPG----QCQTFDYRYRFEQTINNCTQFIWGGCGGNLQNNFETYEQCMQQC 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IM33NP_608800.1 Kunitz_SCI-I-like 24..80 CDD:438677 22/56 (39%)
axoXP_061506652.1 None

Return to query results.
Submit another query.