DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IM33 and SPINT2

DIOPT Version :10

Sequence 1:NP_608800.1 Gene:IM33 / 33592 FlyBaseID:FBgn0031561 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_066925.1 Gene:SPINT2 / 10653 HGNCID:11247 Length:252 Species:Homo sapiens


Alignment Length:70 Identity:23/70 - (32%)
Similarity:34/70 - (48%) Gaps:18/70 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FALVAVALGLKDPICGLPAGIDGNGLIKCAAFIPSFSYHPETNSCEKFIYGGCGGNENRFGTQEL 75
            |.||:..:|                  :|.|.:|.:.|:....||:.|:||||.||.|.:.|:|.
Human    37 FCLVSKVVG------------------RCRASMPRWWYNVTDGSCQLFVYGGCDGNSNNYLTKEE 83

  Fly    76 CEQKC 80
            |.:||
Human    84 CLKKC 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IM33NP_608800.1 Kunitz_SCI-I-like 24..80 CDD:438677 17/55 (31%)
SPINT2NP_066925.1 Kunitz_HAI2_1-like 36..88 CDD:438664 21/68 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..122
Kunitz_HAI2_2-like 131..183 CDD:438665
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.