DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IM33 and si:dkeyp-73b11.8

DIOPT Version :10

Sequence 1:NP_608800.1 Gene:IM33 / 33592 FlyBaseID:FBgn0031561 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001373612.1 Gene:si:dkeyp-73b11.8 / 100333708 ZFINID:ZDB-GENE-131120-176 Length:230 Species:Danio rerio


Alignment Length:59 Identity:20/59 - (33%)
Similarity:27/59 - (45%) Gaps:9/59 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ICGLP--AGIDGNGLIKCAAFIPSFSYHPETNSCEKFIYGGCGGNENRFGTQELCEQKC 80
            ||.||  .|       :|......:.|.||.::|:.|.:.||.||.|||.:...|...|
Zfish    92 ICVLPREPG-------QCFGHYLRYYYSPEHHTCKPFYWTGCVGNGNRFLSLNRCNATC 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IM33NP_608800.1 Kunitz_SCI-I-like 24..80 CDD:438677 19/57 (33%)
si:dkeyp-73b11.8NP_001373612.1 Kunitz_conkunitzin 27..77 CDD:438636
Kunitz_BPTI 92..143 CDD:425421 19/57 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.