DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and Sfp24Bd

DIOPT Version :9

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001162860.1 Gene:Sfp24Bd / 8674028 FlyBaseID:FBgn0259953 Length:111 Species:Drosophila melanogaster


Alignment Length:80 Identity:27/80 - (33%)
Similarity:35/80 - (43%) Gaps:4/80 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLILVFVFVAFVANALALKNAICGLPHSLNGDGRISCEAYIPSWSYDADRNECVKFIYGGCGG 65
            ||||..|.:.....|..|..|..||....|:.|    :|...|..::|:..:|.|.||....|..
  Fly     1 MKLLSAVLLIGTLSAICLGQKEPICRSDPSVVG----NCGHKIKGYTYEVRKNNCKKFRAMACKV 61

  Fly    66 NNNRFNSREICEDKC 80
            ..|.|.||:.|..||
  Fly    62 TGNFFRSRDACNAKC 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 KU 23..81 CDD:238057 19/58 (33%)
Sfp24BdNP_001162860.1 KU 23..76 CDD:294074 17/56 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.