powered by:
Protein Alignment CG16713 and Eppin
DIOPT Version :9
Sequence 1: | NP_608799.1 |
Gene: | CG16713 / 33591 |
FlyBaseID: | FBgn0031560 |
Length: | 82 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_083601.1 |
Gene: | Eppin / 75526 |
MGIID: | 1922776 |
Length: | 134 |
Species: | Mus musculus |
Alignment Length: | 57 |
Identity: | 24/57 - (42%) |
Similarity: | 31/57 - (54%) |
Gaps: | 5/57 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 24 ICGLPHSLNGDGRISCEAYIPSWSYDADRNECVKFIYGGCGGNNNRFNSREICEDKC 80
||.||.... .|.||...|.::.:.:.|..||||||.||||.|.|:.||::.|
Mouse 76 ICSLPKDSG-----YCMAYFRRWWFNKENSTCQVFIYGGCQGNNNNFQSQSICQNAC 127
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4295 |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
59 |
1.000 |
Inparanoid score |
I5407 |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S5562 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000145 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
7 | 6.810 |
|
Return to query results.
Submit another query.