DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and Eppin

DIOPT Version :9

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_083601.1 Gene:Eppin / 75526 MGIID:1922776 Length:134 Species:Mus musculus


Alignment Length:57 Identity:24/57 - (42%)
Similarity:31/57 - (54%) Gaps:5/57 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ICGLPHSLNGDGRISCEAYIPSWSYDADRNECVKFIYGGCGGNNNRFNSREICEDKC 80
            ||.||....     .|.||...|.::.:.:.|..||||||.||||.|.|:.||::.|
Mouse    76 ICSLPKDSG-----YCMAYFRRWWFNKENSTCQVFIYGGCQGNNNNFQSQSICQNAC 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 KU 23..81 CDD:238057 24/57 (42%)
EppinNP_083601.1 WAP 32..72 CDD:278522
Kunitz_BPTI 76..127 CDD:278443 23/55 (42%)
Interaction with SEMG1. /evidence=ECO:0000250 102..133 16/26 (62%)
Interaction with LTF. /evidence=ECO:0000250 117..133 5/11 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I5407
Isobase 1 0.950 - 0 Normalized mean entropy S5562
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000145
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.