DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and spint2

DIOPT Version :10

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001039077.1 Gene:spint2 / 733874 XenbaseID:XB-GENE-947329 Length:394 Species:Xenopus tropicalis


Alignment Length:50 Identity:22/50 - (44%)
Similarity:29/50 - (57%) Gaps:1/50 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 GDGRI-SCEAYIPSWSYDADRNECVKFIYGGCGGNNNRFNSREICEDKCL 81
            |.|.| :|.|..|.|.:||:...|:.|.||||||..|...|.:.|.|:|:
 Frog   198 GKGVIGNCRASFPRWYFDAESQNCISFTYGGCGGTENNHKSVQECADRCI 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 Kunitz_SCI-I-like 24..80 CDD:438677 21/47 (45%)
spint2NP_001039077.1 MANEC 19..104 CDD:471454
Kunitz-type 117..169 CDD:444694
Kunitz-type 195..246 CDD:444694 21/47 (45%)
Kunitz-type 266..318 CDD:444694
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.